PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G18600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 200aa    MW: 21598.3 Da    PI: 6.9148
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G18600.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.1e-151460148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     + +WT+eEde l +av+++   +W+ Ia  ++ +R +k+c++rw ++l
  ORUFI08G18600.1 14 KTPWTQEEDEALRRAVREHRRQNWAEIALALP-RRGPKSCRLRWCQHL 60
                     579*****************************.***********9986 PP

2Myb_DNA-binding47.25.1e-1568109346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +T+eEd +++   + +G++ W+tIar+++ gR+++ +k+rw++
  ORUFI08G18600.1  68 VFTAEEDAIILAQQRVHGNK-WATIARCLP-GRSDNAVKNRWNS 109
                      59******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.271964IPR017930Myb domain
SMARTSM007172.4E-151362IPR001005SANT/Myb domain
SuperFamilySSF466897.26E-2813107IPR009057Homeodomain-like
PfamPF002491.1E-141460IPR001005SANT/Myb domain
CDDcd001672.23E-131660No hitNo description
Gene3DG3DSA:1.10.10.601.1E-211667IPR009057Homeodomain-like
SMARTSM007171.8E-1265113IPR001005SANT/Myb domain
PROSITE profilePS5129416.83267115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-1968113IPR009057Homeodomain-like
PfamPF002499.6E-1268109IPR001005SANT/Myb domain
CDDcd001671.48E-969108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MAADGGDGSG GGRKTPWTQE EDEALRRAVR EHRRQNWAEI ALALPRRGPK SCRLRWCQHL  60
SPELDSRVFT AEEDAIILAQ QRVHGNKWAT IARCLPGRSD NAVKNRWNSA LRKLLQVQHA  120
RGAGSPPAAA AAAAGDDRDD APVCLQLFPA RAGGVKEAGL FAGEKDVEEE DVATSLTLGL  180
PVLCEAELEL RLGPAWPATA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A2e-27141182106MYB3
3zqc_D2e-27141182106MYB3
3zqc_G2e-27141182106MYB3
3zqc_J2e-27141182106MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037980.0AP003798.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1005_H01.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649306.11e-141PREDICTED: transcription factor MYB44-like
TrEMBLA0A0E0QJR71e-142A0A0E0QJR7_ORYRU; Uncharacterized protein
STRINGBGIOSGA028769-PA1e-140(Oryza sativa Indica Group)
STRINGLOC_Os08g34960.11e-140(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.18e-37myb domain protein 77